http://chineseinput.net/에서 pinyin(병음)방식으로 중국어를 변환할 수 있습니다.
변환된 중국어를 복사하여 사용하시면 됩니다.
본 논문은 석사과정 이수를 위한 졸업 작품에서 연주한 자작곡 4곡에 대한 분석적 해설이다. 각 작품의 창작 배경과 형식, 선율 및 화성 구조를 분석하여 작곡자의 작곡 의도와 음악적인 특징들을 설명하고자 한다. 본 작품의 주제는 「놀멍쉬멍」 이다. 예전에는 휴식을 취하는 방법으로 음악을 듣거나 공연, 영화를 보는 것 등 여러 가지 방법이 있었지만, 음악이 직업이 된 후 소리는 휴식하는 것 보다 분석하고 일을 하고 있다는 생각이 들었다. 도시 생활과 음악일 속에서 지쳐갈 때, 훌쩍 떠나 찾아간 제주도에서 들었던 자연의 소리는 일이 아닌 새로운 휴식으로 나에게 다가왔다. 제주도의 자연을 통해 보고 듣고 느꼈던 경험은 작품 제작에 중요한 영감이 되었다. 작품 제목은 ‘놀면서 쉬면서’의 제주방언을 인용하였다. 졸업 공연은 Violin, Accordion, Acoustic Guitar의 Trio 구성으로 연주하였 다. 본론에서는 각 작품의 창작 배경과 음악적 특징들을 분석하고자 한다.
하상퇴적물의 리화학적 특성 및 오염물질 용출에 관한 연구
Comparing to water at the base of river, riverbed deposit shows a small change in time and also shows a great quantity on the earth, which provides characteristics of a suitable geochemical medium in continuously evaluating the environment. This research is focused on developing important essential for studying the effect of long term internal pollution source when riverbed sediment at the entrance of Saemangeum Lake flows into the lake. Following researches were conducted in purpose of finding the characteristics of sediments as internal pollution source. Finding the qualities of sediments piled up at Dongjin River, Mankyung River and studying the pollutant elution due to environmental changes. Brief summary of the results gathered from this research activity will be discussed below. Water quality of Dongjin River and Mankyung River at all spots showed higher concentration rate at summer season compared to winter season. The reason is due to heavy rainfall concentrated during the summer season has increased the inflow of earth and farm water. For sediments, pollutant classified in depth showed similar concentration region in overall. Concentration difference between summer and winter season was little, however winter season had little higher sediment concentration compared to summer. The reason is during the summer season vast amount of pollutant inflow piled up on the riverbed slowly decomposed due to water temperature drop in the winter season and extended retention time, causing it as pollution source inside the sedimentary layer. From the experiment result of natural elution and forced elution, natural elution had no effect from thickness. And anaerobe status showed increased amount of pollutant elution compared to aerobic status. Forced elution formed less than one percent of the total pollutant concentration. Experiment result of adsorption and natural elution of the sediment due to phosphorus concentration demonstrated that water with less than 1.3ppm showed elution from the sediment while water higher than 1.3ppm showed adsorption from the sediment. From sediment particle size analysis result, Mankyung River was classified as silty loam, sandy loam and Dongjin River was classified as sand, loamy sand, silty loam and sandy loam. The sedimentation rate of the sediment was estimated around 9.2~30.0 cm/min for Mankyung river and 0.2~29.3 cm/min for Dongjin river. Considering the ratio of particle classified in size, pollutant concentration of the sediment of Dongjin River was higher compared to Mankyung River when it was lower than 75㎛. Pollutant concentration of sediment by particle size while considering weight ratio showed that more than 70 percent of the pollutant resided in the region where particle size was below 75㎛. Although COD of Dongjin River, Mankyung River sediment showed lower concentration rate compared to Han-river and other regions, it showed relatively high TN and TP values. This phenomenon is displayed because of higher inflow rate of nutrient salts by farm water into the Saemangeum valley compared to other regions. Therefore, result gathered from this research can be used as important base material for studying the long term internal pollutant effect when riverbed sediments flow into the lake hereafter. Also this research result can be used as base material for predicting improvement of the water quality by constructing sedimentation basin that can suppress the sediment inflow and determining validity of dredging the sediment after constructing sedimentation basin.
선초 굴곡된 삶을 산 김시습의 양면적인 삶의 특성이 금오신화에 반영되어 금오신화의 문학적 특성이 현실에 비판하고 저항하는 방외임을 명혼구조와 몽유구조로 분류하여 문학적 특성을 고찰하고 금오신화에 내재하는 현실비판 정신이 후대로 이어짐을 확인 함 『kumosinwha』 is the first novel in korea. and it was created by a new genre which is not yet existed at that time. 『kumoshinwha』 reflect a duplex life of a novelist. one side is his collapsed life in actual reality, and the other side is ideal life in dreamed in his unconsciousness. he literacally try to overcome the frustration, dissatisfation and loneliness caused by high treason which uncle 'prince suyang' rebell king dangjong in 1453. as it called, 'geayoujeongnan'. the novelist of 『kumoshinwha』, kim si sep try to achive official rank as a confucianist, build confucianim utopia. but his dream is frustrated by political coup d'tat by suyangdaegun . and then mr kim wander through aroundthe nation, retreat in kmhomountain. and his literature'view point is changed from orientation for the government to the orientation for antigovernment. the later viewpoint criticize the non justfied actual society allegorially we called it as a literature of bangwoe which is originated from ancient china. existed from our nation corea by the way disfaction of novelist consist individual things and social thing. the first is non-marriage, personal passivity, individual nihility. and the secnd is confusion of phlisophy and revengeful thouts, proper acknowledgement frem the society. but he can't dissolve his unhapiness in reality except by the means of literature. so, he try to dissolve his each dissatisfation with the type of ghost'literature which had vogued in east asia. and the structure of his work is formed two type, the work cotroled individual dissatisfaction is conformed ghost structure which hero meet female ghost in virtual world.in which male hero wed, drink, sex, song with ghost and they dissolve dissatisfaction,transcend reality, and hero arrive ideal world,'bangwoe' which all pain, dissatisfacticn is disappeared, and defarted from distorted current forever. on the contrary social dissatisfaction is conformed dreaming structure which is to meet holy king who dissolve social problems, pains. like this structure the criticism is revealed against actual reality so to speak, novelist find basic cause of drdissatisfaction in actual reality. because he feel the society unhappy caused by distorted political situation. and his cognition is penentrate his work, so his works have critical spirit over actual reality. and this peculiarity is showed not only the text but also in the carater, bacground. rhat's a peculiarity of 『kumhoshinwha』. therefor conclusionally we consider 『kumhosinwha』as a first critical novel called arts of bangwoe. and the tradition of a bangwoe have influence on posterity's literature like 『honggildongeon』 『chunhyanggen』, 『jangilsan』,etc.
모유로부터 분리한 Pediococcus acidilactici균의 항균활성물질 특성 규명 및 효능 평가
모유 유래의 probiotics는 영유아의 위장관 질환 감염에 대한 초기 균총 형성 및 보호 등의 주요 역할을 하는 것으로 알려져 있으며, 최근 모유로부터 probiotics의 생리활성에 대한 유효성 및 적용 가능성에 대한 연구가 다양하게 실시되고 있다. Bacteriocin은 천연 식품보존 효과 및 probiotics으로서 생리활성에 대한 연구가 다양하게 실시되고 있으며, 발효식품 등으로부터 bacteriocin 생산균주를 분리 동정하고 작용기작 및 구조 분석 등의 연구가 이루어지고 있다. Pediocin은 10kDa 이하의 비교적 작은 분자량과 높은 열안전성의 특성을 갖는 bacteriocin class Ⅱa로 분류되고 Pediococcus속이 주로 생산하며, 미생물의 세포막에 pore를 형성하여 사멸시키는 항균 기작을 가지고 있다. Pediocin에 대한 연구는 주로 발효식품으로부터 분리하여 병원성 미생물에 대한 항균성 및 구조분석과 기작 연구에 대하여 이루어졌다. 이에 본 연구에서는 모유에서 유산균을 분리한 후 probiotics의 특성을 규명하고, 유산균이 생산하는 bacteriocin 등과 같은 항균활성물질의 특성 규명 및 in vitro/in vivo 효능을 평가하여 모유 유래 probiotics의 건강기능성에 대한 효능을 확인하였다. 분리된 유산균으로부터 probiotics의 동정을 위하여 위장관 조건에 따른 생존력을 확인하였다. FS4, FS6, FS10 및 FS12는 Pepsin, 담즙산 및 낮은 pH 조건의 실험에서 각 82∼99%, 96∼100% 및 80∼94% 수준의 높은 저항성을 나타내었다. Hydrophobicity과 Auto-aggregation에 대한 실험에서 22∼46%와 12∼34% 수준의 활성을 나타내었다. 또한 Listeria monocytogens ATCC 15313, Staphylococcus aureus ATCC 19095, Bacillus cereus ATCC 14576 및 Escherichia coli O157:H7에 대하여 70∼80% 수준의 co-aggregation 활성을 나타내었다. Gentamicin, Imipenem, Novobiocin, Tetracycline, Clindamycin, Meropenem, Amo]picillin 및 Penicillin 등에 대하여 저항성을 나타내었다. Pediococcus acidilactici에서 분리된 Probiotics는 3kDa 이하의 항균 Peptide로서 LCMS(Liquid Chromatography Mass Spectrometry)를 이용하여 분석하였으며, 항균 Peptide의 아미노산서열을 (KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNDKC)확인하였다. 13C NMR 구조 분석으로 PEDIOCIN을 확인하였다. 기존 연구는 주로 발효식품 등에서 유산균 및 Bacteriocin을 분리하여 그 특성과 유효성을 연구하였으나, 본 연구에서는 모유에서 유산균 및 Bacteriocin을 분리하여 그 특성을 규명하고, Bacteriocin 중 Pediocin의 항균 Peptide의 구조와 유효성을 연구하였다. 본 연구는 모유 수유율이 감소하는 현실에서 모유 수유가 신생아에게 줄 수 있는 건강의 유익성에 대한 가치와 함께, 모유 유래 유산균 및 유산균이 생산하는 Probiotics를 활용한 건강기능성 소재 개발을 위한 과학적 근거의 확보 및 기술적 적용 가능성을 제시하였다. Probiotics isolated from breast milk have been shown to display a wide range of beneficial effects such as the protection against infections and the prevention of gastrointestinal disorders. Moreover, there has been a growing interest in the use of bacteriocins and/or bacteriocin-producing probiotic strains as natural food preservatives and functional food agents. Pediocin, a class IIa bacteriocin produced by Pediococcus strains, has properties of low molecular weight (< 10kDa) and high thermo-stability and showed antimicrobial activity through multiple mechanisms. This study was designed to investigate the physicochemical characteristics of probiotics and bacteriocins isolated from human breast milk and their antimicrobial activity. For identification of probiotics, we first examined bacterial viability at different gastrointestinal conditions. FS4, FS6, FS10, and FS12 showed high resistance of 82∼99%, 96∼100%, and 80∼94% under low levels of pepsin, bile acid, and pH. All of these probiotics showed 22∼46% for hydrophobicity and 12∼34% for auto-aggregation. Along with Listeria monocytogens ATCC 15313, Staphylococcus aureus ATCC 19095, Bacillus cereus ATCC 14576, and Escherichia coli O157:H7, the probiotics showed 70∼80% for co-aggregation. Moreover, we observed the resistance of probiotics against gentamicin, imipenem, novobiocin, tetracycline, clindamycin, meropenem, amo]picillin, and penicillin. The antimicrobial active material isolated from Pediococcus acidilactici was analyzed by using LCMS(liquid chromatography mass spectrometry). Amino acid sequence of antibacterial peptide was identified (KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNDKC) and we confirmed pediocin by using 13C NMR. Most previous research have used probiotics or bateriocins isolated from fermented foods, however the current study examined the probiotics and bateriocins from human breast milk and identified antibacterial peptide of pediocin. This study may provide useful and scientific information for the utilization of human breast milk-derived probiotics as a functional food ingredient.
가토에서 자가골수의 정맥내 주입으로 유발한 폐동맥지방색전증 : 전산화단층촬영과 병리의 연관
지방색전증후군은 심한 외상 후에 나타나며, 특히 장골골절에 많으나 연부조직손상시에도 발생한다. 지방색전증후군은 손상시 골수의 지방구나 혈관에서 합성되는 지방색전이 동맥을 물리적으로 폐쇄하거나 색전된 지방이 분해될 때 생기는 불포화지방산의 독성에 의해 폐손상이 발생하는 것으로 알려져 있다. 지방색전증후군은 주로 폐에 발병하나, 뇌, 신장, 피부 등 여러 장기에 병발하여 호흡곤란, 청색증, 혼미, 반상출현, 지방뇨, 빈뇨 등 다양한 증상과 임상 결과를 보여, 심할 경우 호흡부전으로 사망하기도 한다. 지방생전증후군이 여러 장기의 손상을 유발하나 예후는 폐색전정도에 의존하므로, 폐지방색전증의 조기진단 및 적극적 치료에 필수적이다. 그러나 폐지방색전증의 방사선학적소견은 임상증상이나 동맥저산소증이 있더라도 초기나 경한 경우에 방사선검사 상 뚜렷한 이상소견이 없어 조기진단에 큰 도움을 주지 못한다. 폐지방새전증의 방사선학적소견은 폐부종에 의한 양측성미만성폐음영이 가장 두드러지며, 국소적반점상음영의 출현과 이의 진행에 의해 보이는 눈보라폐음영(snow storm-like appearance)이 나타나며, 이는 병리학적으로 국소적출혈이나 무기폐, 폐포내부종 또는 경색에 의한 것으로 알려져 왔다. 폐지방색전증의 전산화단층촬영(이하 CT) 소견은 미만성폐경결과 경계가 불분명한 다발성결절성병변이 나타나며 추적검사상 간유리음영과 희미한 결절로 변하며, 병변의 위치는 주로 변연부라는 보고가 있기는 하나, 폐지방색전증의 CT소견은 아직 정립되지 않았으며, 병리학적인 연관 해석에 대해서도 알려진 바 없어 본 연구에서는 동물실험을 통해 폐지방색전증의 흉부 CT소견을 정리하고 각 소견의 병리학적 근거를 제시하고자 한다. 특히 단순흉부X선에서는 이상 소견이 나타나지 않는다고 알려진 초기에 CT상 병변의 발현여부 및 그 소견을 분석하고 추적검사를 통하여 변화 과정을 정리함으로써 지방색전증에 관한 실험적 기초자료를 구축하고자 하였다.
숯의 종류에 따른 흡착력과 재활용성에 관한 실험적 연구
박성진 전북대학교 산업기술대학원 2007 국내석사
본 연구는 숯의 효과에 대한 정량적인 분석을 위해 실내 공기 정화용으로 많이 사용하는 참나무 숯과 대나무 숯을 사용하여 숯의 종류에 따른 흡착특성 및 최대흡착성능과 숯의 재활용에 따른 효과를 평가하여 숯의 효과적인 활용을 위한 기본적인 자료를 제공하는데 그 목적이 있다. The house supply was quantity rather than quality to a house famine solved. But it reported a case to increased taken ill to inner environment continuously. Also, the general public toke a growing interest in housing environment. The Government take effect restrictions and guides. For example, new building inducement new materials, ventilator, purifier to a little component and release chemical. For such reason, construction and building materials business worlds applied to new methods. But, its bring up a problem to high price and upkeep, management. So, it toke a growing interest in a method to use natural materials. Among the rest, Charcoals are used multifarious for a long time ago and these days are used too. But it was few reports to scientific study. This paper was quantitative analysis to use Oak and Bamboo charcoals and it tested adsorption ability, the maximum adsorption ability and recycling effect.